PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS512834.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LFY
Protein Properties Length: 229aa    MW: 26085.2 Da    PI: 5.7221
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS512834.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY261.43.7e-801221046259
       FLO_LFY  46 rklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetald 142
                   r++ +leelf+ayG+rylt+++iae+Gft++tL+dmk+eeldd+m+sls+ifr+dllvGeryGikaa+raerrrl e++ +++r++l s+d ++ ld
  EcS512834.10  12 RTMGGLEELFEAYGIRYLTASRIAEMGFTANTLLDMKEEELDDMMNSLSHIFRWDLLVGERYGIKAAIRAERRRLLEAD-DHRRHHLHSTD-HALLD 106
                   55789************************************************************************88.55555555566.568** PP

       FLO_LFY 143 alsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepg 239
                   als++glsee+v ++ e+ + g++g+g+++ +   +   ++++kk+    ++r++ + +k +     +ee+dede  +  +++ rqrehPfivtepg
  EcS512834.10 107 ALSHQGLSEEQVMQHSEKDQLGRAGSGDTAGTSWGA---QQQRKKH----RHRHRITAMKGA----ATEEDDEDE--EEVEEMRRQREHPFIVTEPG 190
                   ************997777776666644444443331...1222222....222222222211....122222222..3334578************* PP

       FLO_LFY 240 evargkknGLDYLfdLyeqC 259
                   evargkknGLDYLf+Lyeq 
  EcS512834.10 191 EVARGKKNGLDYLFHLYEQV 210
                   ******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.3E-778210IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MDPEAFAVVG LRTMGGLEEL FEAYGIRYLT ASRIAEMGFT ANTLLDMKEE ELDDMMNSLS  60
HIFRWDLLVG ERYGIKAAIR AERRRLLEAD DHRRHHLHST DHALLDALSH QGLSEEQVMQ  120
HSEKDQLGRA GSGDTAGTSW GAQQQRKKHR HRHRITAMKG AATEEDDEDE EEVEEMRRQR  180
EHPFIVTEPG EVARGKKNGL DYLFHLYEQV PRLPPPSPIP GQGAGREMP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ude_B2e-271486880GINLFY PROTEIN
4ude_A2e-271486880GINLFY PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010039002.11e-136PREDICTED: leafy/floricaula homolog FL1
SwissprotO649531e-137FL1_EUCGL; Leafy/floricaula homolog FL1
TrEMBLA0A059A3351e-136A0A059A335_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s11820.19e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.14e-46floral meristem identity control protein LEAFY (LFY)